Pay in 4 interest-free payments of $5.66 Learn more
Ships within 48 hours · Estimated delivery Aug 8 - Aug 13
Evolutionary and structural insights into the multifaceted glutathione peroxidase (Gpx) superfamily
Rather than masking damage, Glutathione and NAD+ get to the root of the problem, restoring skin from the inside out
Tesamorelin and Ipamorelin Peptide Structure Tesamorelin Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL Molecular Formula: C 223 H 370 N 72 O 69 S Molecular Weight: 5196 g/mol PubChem CID: 44147413 CAS Number: 901758-09-6 Synonyms: Tesamorelin acetate 901758-09-6 TH9507 UNII-LGW5H38VE3 Tesamorelin acetate [USAN] Ipamorelin Sequence: Aib-His-D-2Nal-D-Phe-Lys Molecular Formula: C 38 H 49 N 9 O 5 Molecular Weight: 711.9 g/mol PubChem CID: 9831659 CAS Number: 170851-70-4 Synonyms: 170851-70-4 Ipamorelin [INN] NNC-26-0161 UNII-Y9M3S784Z6 Lyophilized Peptides: These peptides are freeze-dried, a process that not only extends shelf life but also preserves the purity and integrity of the peptides during storage
L-glutathione reduced, vitamin E (D-alpha tocopheryl acetate), L-lysine, anti-caking agent: magnesium salts of fatty acids
Educational only No protocols No purchase required Final Notes & Disclaimers The protocols described above are for information purposes only
i ng y bc s, iu dng chuyn mn cao trong iu tr cc bnh v da, s hu trang thit b hin i nht th gii tng ng vi cc bnh vin ti M, c, Anh, Nht Bn, Singapore gip h tr khm, chn on v iu tr cc bnh v da hiu qu
US$ 20.03
US$ 22.45
US$ 27.63
US$ 22.52
